General Information

  • ID:  hor000193
  • Uniprot ID:  P55322
  • Protein name:  Molt-inhibiting hormone-like
  • Gene name:  NA
  • Organism:  Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  X-organ of the eyestalk
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DTFDHSCKGIYDRELFRKLDRVCEDCYNVFREPKVATECKSNCFVNKRFNVCVADLRHDVSRFLKMANSALS
  • Length:  72(31-102)
  • Propeptide:  LEKLLSSSSSSSGSSSPLDALGGDHSVNKRDTFDHSCKGIYDRELFRKLDRVCEDCYNVFREPKVATECKSNCFVNKRFNVCVADLRHDVSRFLKMANSALS
  • Signal peptide:  LEKLLSSSSSSSGSSSPLDALGGDHSVNKR
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P55322-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000193_AF2.pdbhor000193_ESM.pdb

Physical Information

Mass: 972226 Formula: C366H574N108O109S7
Absent amino acids: QW Common amino acids: DRVCFK
pI: 8.12 Basic residues: 15
Polar residues: 21 Hydrophobic residues: 23
Hydrophobicity: -46.53 Boman Index: -19707
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 66.25
Instability Index: 4448.75 Extinction Coefficient cystines: 3355
Absorbance 280nm: 47.25

Literature

  • PubMed ID:  8055060
  • Title:  Molecular Cloning and Sequence Analysis of a cDNA Encoding a Molt-Inhibiting Hormone-Like Neuropeptide From the White Shrimp Penaeus Vannamei